help  | faq  | software  | BAR

Sequence :

Length  373 Residues  MTIMFKIAKATLRNRNSSVASLFYSIQARSISRQSKVVKIERMVEKEDMHVTRVLFCGPHFPDSYNFTREYLQPYPFIKVDVVHYRDVPEVIKNYHICVAMTMQMDSNVISRASNIKLIMQYGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEMAIYLMLGLLKKQNEMQISLRNRLLGEPTGDTLLGKTVFILGYGNIGIELAKRLKPFGSRVIATKRFWPASIVDSDSRLVDEKGSHEDIYTFAGKADIVVVCLRLNKETAEIVNKEFICSMKKGALLVNIARGGLINYESAFQNLESGHLGGLGIDVAWSEPFDPNDPILKFKNVIITPHVAGVTEYSYRSMAKIVGDLALQLHEGLPLTGIEFVN
MD5 Checksum  420422b788470a473ccd9fe3aec257b3